Machine Learning

There are 4 entries for the tag Machine Learning
Bioinformatics: Sequence Alignment Algorithms

  La Bioinformatica è una disciplina scientifica dedicata alla risoluzione di problemi biologici con metodi informatici; le attività di base della Bioinformatica comprendono il retrieval delle informazioni all' interno di databases biologici, il confronto fra sequenze genomiche e la rappresentazione delle strutture proteiche. Prima di analizzare le tecniche di allineamento fra sequenze proteiche, volevo ricordare come quest' ultime siano composte dai 20 tipi di amminoacidi presenti in natura; una proteina sarà quindi composta da una particolare sequenza di amminoacidi come nel caso dell' insulina (prima proteina scoperta nel '51)                                                                       insulina = MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERG                                                                       FFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLY                                                                      QLENYCN Ogni giorno all' interno dei laboratori di tutto...

posted @ Tuesday, October 9, 2007 6:59 PM | Feedback (1)

[University Stuff] Machine Learning Applied

Dopo un bel pò di tempo (troppo per la verità) finalmente vediamo di mettere in pratica quello che vi ho raccontato nei post precedenti (1, 2) riguardo all' Apprendimento Automatico. Per coloro che vogliono approfondire di più la conoscenza dell' Apprendimento Automatico con particolare riferimento alle SVM esistono diverse risorse in rete tra le quali spiccano: www.kernel-machines.org (sito contenente informazioni generali sia di carattere tecnico che relativo ai vari eventi internazionali) www.kernel-methods.net (sito contenente informazioni riguardanti il libro "Kernel Methods for Pattern Analysis",testo scritto da due guru del settore quali John Shawe-Taylor e Nello Cristianini che tratta in...

posted @ Friday, May 11, 2007 6:30 PM | Feedback (7)

[University Stuff] Machine Learning II

  Nello post precedente vi ho introdotto quelli che sono i concetti base dell' Apprendimento Automatico; senza scendere troppo nelle dimostrazioni matematiche vi illustrerò una serie di metodi basati sull'Apprendimento con supervisone di nome Support Vector Machines (SVM). Le SVM trovano impiego sia nella risoluzione di problemi di classificazione (spam) che nei problemi di regressione. Prima di scendere in dettaglio devo fare alcuni richiami matematici sui vettori e le loro proprietà ... speriamo bene    In R2 (geometricamente, nel piano) i punti sono rappresentati da coppie ordinate (x1,x2) di numeri reali (coordinate).Tali punti sono facilmente rappresentabili attraverso dei segmenti orientati                                                                    Un punto...

posted @ Friday, November 17, 2006 12:25 PM | Feedback (2)

[University Stuff] Machine Learning

Con questo post voglio raccontarvi qualcosa sull' Apprendimento Automatico rimandando se di vostro interesse ad un prossimo post una trattazione delle Support Vector Machines (SVM). No, non pensate che siano cose totalmente astratte in quanto sul loro utilizzo si basano programmi che utilizzate quotidianamente . L' Apprendimento Automatico nasce come una sottoarea dell' Intelligenza artificiale; nel corso degli ultimi anni ha comunque raggiunto una completa autonomia nei confronti di quest'ultima. L'idea che sta alla base del Machine Learning è che i pc non vengano più programmati a mano bensì abbiano la capacità di programmarsi da soli. La programmazione tradizionale in alcuni contesti presenta infatti delle...

posted @ Thursday, November 16, 2006 2:06 PM | Feedback (11)