.NET

There are 10 entries for the tag .NET
Aggiornamento Data Structure and Algorithms Book

Proprio prima di Natale, con il mio amico Granville abbiamo rilasciato un aggiornamento del libro gratuito che abbiamo scritto su algoritmi e strutture dati. Sono stati introdotti alcuni capitoli aggiuntivi e revisionati quelli già presenti nella prima release. I numeri lasciano spesso il tempo che trovano però aver ricevuto oltre 14.000 download per l'ultima release fà davvero piacere. Data Structures and Algorithms: Annotated Reference with Examples Technorati Tag: .NET,Data Structure

posted @ Friday, December 19, 2008 10:00 AM | Feedback (10)

Download gratuto: Data Structure and Algorithms eBook

E' con grande piacere che dopo alcuni mesi di gestazione insieme al mio amico Granville, abbiamo pubblicato il libro  Data Structures and Algorithms: Annotated Reference with Example. Allo stato attuale il libro è ancora un work in progress ma personalmente sono soddisftatto di come sia evoluto nel corso del tempo (sono un pò di parte... ). Il libro è rivolto a tutti coloro che conoscono un linguaggio di programmazione ad oggetti, senza particolari requisiti; l'utilizzo dello pseudo codice pone infatti l'attenzione sulla parte algoritmica piuttosto che su quella di implementazione. La scelta di renderlo totalmente free è data dalla convinzione che...

posted @ Wednesday, August 27, 2008 7:45 PM | Feedback (12)

Joining DSA project

Sono appena entrato a far parte del progetto DSA (Data Structure and Algorithms) giunto in questi giorni alla versione 0.5. Far parte di questo progetto per me è uno stimolo davvero interessante e per questo ringrazio il mio amico Granville Barnett, fondatore del progetto. Compito della libreria DSA è quello di cercare di colmare le lacune presenti all' interno della BCL in quanto ad algoritmi e strutture dati. In questi giorni stiamo lavorando con Granville per decidere quali strutture ed algoritmi implementare sino al rilascio della versione 1.0. Devo subito dire che la metodologia TDD adottata da Granville aiuterà a...

posted @ Monday, June 2, 2008 4:58 PM | Feedback (4)

DevCon 2008 Review and beyond

Anche questo anno ho avuto la fortuna di partecipare a DevCon e devo dire che come per lo scorso anno il bilancio è decisamente positivo. Innanzitutto sembra strano ma anche in questo caso, avere già l'esperienza di una devcon alle spalle ha sicuramente giovato sia nella scelta delle sessioni da seguire (2 track parallelle) che nell' aver acquisito una certà familiarità con alcuni dei concetti esposti. Senza entrare troppo nel dettaglio cercherò di evidenziare alcune riflessioni personali nate dalle sessioni che ho seguito. WCF Per quanto riguarda WCF, c'è davvero poco da dire in quanto i benefici che questa piattaforma ha...

posted @ Monday, June 2, 2008 4:26 PM | Feedback (11)

Nth Root

In questo post mostro poche linee di codice che permettono di calcolare la radice ennesima (nth-root) di un numero in C#. Prima di buttar giù queste righe di codice mi sono chiesto se nel framework ci fosse qualche cosa che facesse al caso mio... risposta negativa :(  Con l' ausilio di un pò di matematica però si può ovviare a ciò, sfruttando la definizione di logaritmo e le proprietà che lo legano alla funzione esponenziale. Possiamo infatti scrivere: La dimostrazione di questa formula è piuttosto semplice in quanto la prima uguaglianza è una proprietà che deriva dalla nozione di base...

posted @ Sunday, May 18, 2008 12:47 PM | Feedback (10)

Bioinformatics: Sequence Alignment Algorithms

  La Bioinformatica è una disciplina scientifica dedicata alla risoluzione di problemi biologici con metodi informatici; le attività di base della Bioinformatica comprendono il retrieval delle informazioni all' interno di databases biologici, il confronto fra sequenze genomiche e la rappresentazione delle strutture proteiche. Prima di analizzare le tecniche di allineamento fra sequenze proteiche, volevo ricordare come quest' ultime siano composte dai 20 tipi di amminoacidi presenti in natura; una proteina sarà quindi composta da una particolare sequenza di amminoacidi come nel caso dell' insulina (prima proteina scoperta nel '51)                                                                       insulina = MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERG                                                                       FFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLY                                                                      QLENYCN Ogni giorno all' interno dei laboratori di tutto...

posted @ Tuesday, October 9, 2007 6:59 PM | Feedback (1)

[University Stuff] Kernel Gaussiano

Solitamente un kernel gaussiano viene utilizzato come filtro di smoothing per diminuire il rumore presente nelle immagini o come kernel per una SVM.In questi giorni ho avuto la necessità di eseguire una convoluzione fra una matrice a valori reali ed un kernel gaussiano; mi sono quindi creato un piccolo metodo di cui vi allego il codice... private static double[,] gaussian(int length) { //Dimensione dispari if (length % 2 == 0) ...

posted @ Thursday, August 2, 2007 2:38 PM | Feedback (4)

Alberi Binari powered by Custom Iterator

In questi gg di "lenta" preparazione in vista dell' esame 70-536 ho deciso di approfondire alcuni caratteristiche sia del framework che di C# 2.0  ... Mi sono detto: perchè nn buttare giù alcune linee di codice che coprano Generics , Custom Iterator conditi con alcune reminescenze universitarie che vanno sotto il nome di alberi binari?!!! Cominciano con la definizione della struttura dati presa in esame, utilizzando una definizione ricorsiva: Un albero binario è composto da un nodo radice, da un sottolabero destro e da un sottoalbero sinistro   Dalla definizione sopra esposta viene in modo naturale definire una classe del tipo:  1: public class BinaryTree where...

posted @ Tuesday, May 1, 2007 3:56 PM | Feedback (3)

XmlReader to XmlDocument

SqlServer sin dalla versione 7.0 (non sono sicuro ancora pensavo ad altro  ) supporta il retrieving dei dati sotto forma di xml grazie all'utilizzo di particolari parametri quali "FOR XML [RAW | AUTO [ELEMENTS] | EXPLICIT]". Un tipico codice di accesso ai dati che utilizzi una query FOR XML potrebbe avere una forma del tipo : 1: string queryForXml ="SELECT Customers.ContactName FROM Customers FOR XML AUTO, ELEMENTS"; 2: string connectionString = ConfigurationManager.AppSettings["ConnectionString"]; 3: SqlConnection sqlconnection = new SqlConnection(connectionString); ...

posted @ Thursday, March 15, 2007 10:07 PM | Feedback (1)

Architecture Days - Day One Review

Comincio questa mia piccola recensione ringraziando tutti coloro che organizzano questi tipi di incontri perchè permettono sia una migliore conoscenza delle tematiche più squisitamente tecniche sia un costruttivo scambio di idee con molti ed eterogenei sviluppatori. Dopo questa breve premessa (==ruffianata) iniziale posso dire che la giornata è cominciata alle 10.20 ( odio personalmente perdere tempo così ma a volte è inevitabile) con una breve introduzione di Andrea che ha proposto il progetto GUISA; approvo questa scelta sperando che le informazioni non vengano sparpagliate fra UGI e il neonato progetto. La prima sessione di Andrea è continuata con la definizione di architettura enfatizzando i falsi luoghi comuni...

posted @ Thursday, October 19, 2006 4:36 PM | Feedback (4)