October 2007 Blog Posts

Bioinformatics: Sequence Alignment Algorithms

  La Bioinformatica è una disciplina scientifica dedicata alla risoluzione di problemi biologici con metodi informatici; le attività di base della Bioinformatica comprendono il retrieval delle informazioni all' interno di databases biologici, il confronto fra sequenze genomiche e la rappresentazione delle strutture proteiche. Prima di analizzare le tecniche di allineamento fra sequenze proteiche, volevo ricordare come quest' ultime siano composte dai 20 tipi di amminoacidi presenti in natura; una proteina sarà quindi composta da una particolare sequenza di amminoacidi come nel caso dell' insulina (prima proteina scoperta nel '51)                                                                       insulina = MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERG                                                                       FFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLY                                                                      QLENYCN Ogni giorno all' interno dei laboratori di tutto...

posted @ Tuesday, October 9, 2007 6:59 PM | Feedback (1)