AI

There are 8 entries for the tag AI
Data Mining Algorithms : Microsoft Association Rules Revealed

Dopo l' introduzione del post precedente, oggi esamineremo la fase cruciale e maggiormente complessa di ogni algoritmo di Association Mining ovvero la fase di estrazione dei frequent pattern. Ricordo che i frequent pattern sono gli insiemi di prodotti che hanno supporto maggiore di quello minimo. Possiamo effettuare una prima classificazione degli algoritmi di frequent pattern mining individuando da una parte quelli che si basano su di un processo iterativo di generazione di itemset candidati, dall' altra quelli che calcolano i frequent pattern senza questo processo.  ESTRAZIONE FREQUENT CON GENERAZIONE DEI CANDIDATI Questa famiglia vede come capostite il...

posted @ Wednesday, April 16, 2008 7:01 PM | Feedback (5)

Data Mining Algorithms : Microsoft Association Rules Introduction

Oggi voglio analizzare ed illustrare uno dei task maggiormente ricorrenti quando si ha a che fare con operazioni di Data Mining, l' Association Mining. Farò riferimento sia all' implementazione fornita all' interno della suite di algoritmi di Data Mining inclusi in SSAS che ad ulteriori approcci maggiormente efficienti.Defiamo innanzitutto che cosa sia l'Association Mining con riferimento a possibili contesti applicativi. Un algoritmo di Association Mining permette di identificare all' interno di un insieme di prodotti (itemset) delle regole che correlano la presenza di un insieme di prodotti con quella di un altro insieme; vengono quindi dapprima estratti dei pattern frequenti e...

posted @ Tuesday, April 15, 2008 5:57 PM | Feedback (5)

Bioinformatics: Sequence Alignment Algorithms

  La Bioinformatica è una disciplina scientifica dedicata alla risoluzione di problemi biologici con metodi informatici; le attività di base della Bioinformatica comprendono il retrieval delle informazioni all' interno di databases biologici, il confronto fra sequenze genomiche e la rappresentazione delle strutture proteiche. Prima di analizzare le tecniche di allineamento fra sequenze proteiche, volevo ricordare come quest' ultime siano composte dai 20 tipi di amminoacidi presenti in natura; una proteina sarà quindi composta da una particolare sequenza di amminoacidi come nel caso dell' insulina (prima proteina scoperta nel '51)                                                                       insulina = MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERG                                                                       FFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLY                                                                      QLENYCN Ogni giorno all' interno dei laboratori di tutto...

posted @ Tuesday, October 9, 2007 6:59 PM | Feedback (1)

[University Stuff] Genetic Algorithms Applied

Dopo la rassegna prettamente teorica con cui abbiamo analizzato gli Algoritmi Genetici, vediamo tramite un semplice esempio come sia possibile mettere in pratica i principi sui quali si fondano. L' esempio che prenderemo in considerazione è il classico problema dello zaino (Knapsack Problem): supponiamo di dover partire per le tanto attese vacanze estive; supponiamo inoltre di avere una valigia con una capacità C limitata, e un insieme di n oggetti ciascuno con un peso wi e un valore ci; il problema consiste nel decidere quali oggetti mettere in valigia massimizzandone il valore, non superando la capacità massima della valigia. In termini un pò più formali possiamo definire...

posted @ Tuesday, July 24, 2007 6:49 PM | Feedback (6)

[University Stuff] Genetic Algorithms

Visto l' ottimo interesse suscitato, sia all' interno della community che all' esterno ( due tesisti mi hanno contattato dopo aver letto i miei post sul Machine Learning), voglio presentarvi un metodo molto interessante che viene utilizzato per risolvere problemi di ottimizazzione: gli Algoritmi Genetici (AG). Gli algoritmi genetici costituiscono un sottoinsieme degli Algoritmi Evolutivi, termine generico che indica una gamma di sistemi di risoluzione dei problemi che riproducono il processo evolutivo cosi come descritto nella teoria Darwiniana. Tra la fine degli anni '50 e l'inizio degli anni '60 alcuni ricercatori cominciarono a interessarsi ai sistemi naturali nella convinzione che potessero fornire le...

posted @ Monday, July 23, 2007 4:57 PM | Feedback (5)

[University Stuff] Machine Learning Applied

Dopo un bel pò di tempo (troppo per la verità) finalmente vediamo di mettere in pratica quello che vi ho raccontato nei post precedenti (1, 2) riguardo all' Apprendimento Automatico. Per coloro che vogliono approfondire di più la conoscenza dell' Apprendimento Automatico con particolare riferimento alle SVM esistono diverse risorse in rete tra le quali spiccano: www.kernel-machines.org (sito contenente informazioni generali sia di carattere tecnico che relativo ai vari eventi internazionali) www.kernel-methods.net (sito contenente informazioni riguardanti il libro "Kernel Methods for Pattern Analysis",testo scritto da due guru del settore quali John Shawe-Taylor e Nello Cristianini che tratta in...

posted @ Friday, May 11, 2007 6:30 PM | Feedback (7)

[University Stuff] Machine Learning II

  Nello post precedente vi ho introdotto quelli che sono i concetti base dell' Apprendimento Automatico; senza scendere troppo nelle dimostrazioni matematiche vi illustrerò una serie di metodi basati sull'Apprendimento con supervisone di nome Support Vector Machines (SVM). Le SVM trovano impiego sia nella risoluzione di problemi di classificazione (spam) che nei problemi di regressione. Prima di scendere in dettaglio devo fare alcuni richiami matematici sui vettori e le loro proprietà ... speriamo bene    In R2 (geometricamente, nel piano) i punti sono rappresentati da coppie ordinate (x1,x2) di numeri reali (coordinate).Tali punti sono facilmente rappresentabili attraverso dei segmenti orientati                                                                    Un punto...

posted @ Friday, November 17, 2006 12:25 PM | Feedback (2)

[University Stuff] Machine Learning

Con questo post voglio raccontarvi qualcosa sull' Apprendimento Automatico rimandando se di vostro interesse ad un prossimo post una trattazione delle Support Vector Machines (SVM). No, non pensate che siano cose totalmente astratte in quanto sul loro utilizzo si basano programmi che utilizzate quotidianamente . L' Apprendimento Automatico nasce come una sottoarea dell' Intelligenza artificiale; nel corso degli ultimi anni ha comunque raggiunto una completa autonomia nei confronti di quest'ultima. L'idea che sta alla base del Machine Learning è che i pc non vengano più programmati a mano bensì abbiano la capacità di programmarsi da soli. La programmazione tradizionale in alcuni contesti presenta infatti delle...

posted @ Thursday, November 16, 2006 2:06 PM | Feedback (11)